PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400041157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 329aa    MW: 36090.6 Da    PI: 4.4335
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400041157genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA41.41.9e-13165199135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C +Cg  +TplWR gp  ++ LCnaCGl+++ k++
  PGSC0003DMP400041157 165 CCHCGIEQTPLWRPGPTAKPVLCNACGLRWQTKET 199
                           99**************99999*********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.2E-8159217IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-11162200No hitNo description
CDDcd002027.54E-11164194No hitNo description
PROSITE profilePS5011411.147165192IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-12165199IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.5E-11165199IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MCTNVHLLFG EADKDPHLNP VSVPRRKRSK LRQCILSPAQ IQRTLDNNLQ APDFEIISDG  60
DEPVTLIYAR NKYIPPNEVG LGAMLLVSPT TTTERLTPLS AMAVPPNEIG HEPMLLVSPT  120
TTIERSTPQL AMEEDTVSCS MDQYIQPDLN WNHSEPDFMG KQGPCCHCGI EQTPLWRPGP  180
TAKPVLCNAC GLRWQTKETL DDYLPKHAST ELPSEMKLEV GEEVSGQDGS SACLEEEMIN  240
ISSLGSAGSS PDKCMQMEET NVSSVLLDGI FRHVNSEVYN ACLPTSLRNN NVLEYVAMQN  300
ETTGNKDGNE NACDNGLAPH HMDTTERA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2396511e-161AC239651.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-250c18 map 1, complete sequence.
GenBankHG9755131e-161HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062574.18e-69PREDICTED: uncharacterized protein LOC107008161
TrEMBLM1C7350.0M1C735_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000611250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125821014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.11e-20GATA transcription factor 26
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]